Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOR4A Peptide - C-terminal region

TOR4A Peptide - C-terminal region

Product Specifications

Product Name Alternative

C9orf167

UniProt

Q9NXH8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOR4A Rabbit Polyclonal Antibody (orb326718) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060193

Preservative

Lyophilized powder

AA Sequence

QYHARHHCPEARAAQDCREELARRVADVVARAEAEEKTPLLVLDDVELMP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,3-Dibromopropane
TRC-D425850-500MG 500 mg

1,3-Dibromopropane

Sign In for Pricing
View Details
5-Hydroxy Diclofenac
TRC-H825230-25MG 25 mg

5-Hydroxy Diclofenac

Sign In for Pricing
View Details
JNK1 (MAPK8) Human Gene Knockout Kit (CRISPR)
KN418407 1 Kit

JNK1 (MAPK8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE Anti-Human IgD Antibody[IA6-2]
E-AB-F1171D-01 20 Tests

PE Anti-Human IgD Antibody[IA6-2]

Sign In for Pricing
View Details
PE Anti-Human IgD Antibody[IA6-2]
E-AB-F1171D-02 100 Tests

PE Anti-Human IgD Antibody[IA6-2]

Sign In for Pricing
View Details
PE Anti-Human IgD Antibody[IA6-2]
E-AB-F1171D-03 2x 100 Tests

PE Anti-Human IgD Antibody[IA6-2]

Sign In for Pricing
View Details