Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBATA Peptide - C-terminal region

TBATA Peptide - C-terminal region

Product Specifications

Product Name Alternative

C10orf27, spatial

UniProt

Q96M53

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBATA Rabbit Polyclonal Antibody (orb326720) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689923

Preservative

Lyophilized powder

AA Sequence

EPPCSQSPKKTKISPFTKSEKPEYIGEAQVLQMHSSQNTEKKTSKPRAES

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Prolactin R Antibody (T6) [HRP]
NB300-531H 0.1 mL

Mouse Monoclonal Prolactin R Antibody (T6) [HRP]

Sign In for Pricing
View Details
CASTROVIEJO Spring Scissors w/pin-S/S Str/14.5*3.2mm/14cm
S11019-14 1 PC

CASTROVIEJO Spring Scissors w/pin-S/S Str/14.5*3.2mm/14cm

Sign In for Pricing
View Details
4- (1,3-Dioxolan-2-yl) -N'-hydroxy-benzenecarboximidamide
sc-313868A 1 g

4- (1,3-Dioxolan-2-yl) -N'-hydroxy-benzenecarboximidamide

Sign In for Pricing
View Details
Guinea pig Anti-Thrombin III (AT-III) ELISA Kit
EIA05339Gu 1 Kit

Guinea pig Anti-Thrombin III (AT-III) ELISA Kit

Sign In for Pricing
View Details
ALDH3A1 Rabbit Polyclonal Antibody
E53P12989 100 µL

ALDH3A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Krtap14 qPCR Primer Pair
QM24074S 200 Tests

Mouse Krtap14 qPCR Primer Pair

Sign In for Pricing
View Details