TBATA Peptide - C-terminal region
TBATA Peptide - C-terminal region
Product Specifications
Product Name Alternative
C10orf27, spatial
UniProt
Q96M53
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TBATA Rabbit Polyclonal Antibody (orb326720) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689923
Preservative
Lyophilized powder
AA Sequence
EPPCSQSPKKTKISPFTKSEKPEYIGEAQVLQMHSSQNTEKKTSKPRAES
More Discoveries
Explore Other Products
Browse additional items from our catalog
0004-01V-AP 100 µL
4-1BB Ligand (4-1BBL, 4-1BB-L, CD137L, CD157L, Homolog of Mouse 4-1BB-L, Homolog of Mouse 4-1BBL, ILA Ligand (TNF-related), Ly63L, Receptor 4-1BB Ligand, Tumor Necrosis Factor (Ligand) Superfamily Member 9) (AP) discontinued
Sign In for Pricing
View Details 
495898 100 µL
ZC3H15 (Zinc Finger CCCH Domain-Containing Protein 15, Zinc Finger CCCH-Type Containing 15)
Sign In for Pricing
View Details 