C10orf90 Peptide - C-terminal region
C10orf90 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FATS, bA422P15.2
UniProt
Q96M02
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C10orf90 Rabbit Polyclonal Antibody (orb326721) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004298
Preservative
Lyophilized powder
AA Sequence
QDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSPA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680977-500 1x 500 µL
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682387-500 1x 500 µL
SOX9 / SRY-box 9 (SOX9/2387), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042475-500 1x 500 µL
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details