Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBWD2 Peptide - C-terminal region

CBWD2 Peptide - C-terminal region

Product Specifications

UniProt

Q8IUF1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CBWD2 Rabbit Polyclonal Antibody (orb326743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_742000

Preservative

Lyophilized powder

AA Sequence

TFEVPGNAKEEHLNMFIQNLLWEKNVRNKDNHCMEVIRLKGLVSIKDKSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIPIN Recombinant Protein (Human)
RP031633 100 µg

TIPIN Recombinant Protein (Human)

Sign In for Pricing
View Details
Mouse FTHL17 siRNA
abx917276-01 15 nmol

Mouse FTHL17 siRNA

Sign In for Pricing
View Details
Mouse FTHL17 siRNA
abx917276-02 30 nmol

Mouse FTHL17 siRNA

Sign In for Pricing
View Details
Anti-α-1-antitrypsin Antibody
13704-500 500ug

Anti-α-1-antitrypsin Antibody

Sign In for Pricing
View Details
ABCE1 siRNA (Mouse)
CRM4632-01 15 nmol

ABCE1 siRNA (Mouse)

Sign In for Pricing
View Details
ABCE1 siRNA (Mouse)
CRM4632-02 30 nmol

ABCE1 siRNA (Mouse)

Sign In for Pricing
View Details