Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC86 Peptide - N-terminal region

CCDC86 Peptide - N-terminal region

Product Specifications

UniProt

Q9H6F5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC86 Rabbit Polyclonal Antibody (orb326747) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077003

Preservative

Lyophilized powder

AA Sequence

ESPQRQPEYSPESPRCQPKPSEEAPKCSQDQGVLASELAQNKEELTPGAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Insect Wolbachia ELISA Kit
IEK071-01 48 Tests

Insect Wolbachia ELISA Kit

Sign In for Pricing
View Details
Insect Wolbachia ELISA Kit
IEK071-02 96 Tests

Insect Wolbachia ELISA Kit

Sign In for Pricing
View Details
Recombinant Human RAB13 Protein
E30P4902 20 µg

Recombinant Human RAB13 Protein

Sign In for Pricing
View Details
Human KRT7 Pre-designed siRNA Set A
SI008393A 1 Each

Human KRT7 Pre-designed siRNA Set A

Sign In for Pricing
View Details
2,5-Diphenyl-2H-pyrazole-3-carboxylic acid
FD57108-01 250 mg

2,5-Diphenyl-2H-pyrazole-3-carboxylic acid

Sign In for Pricing
View Details
2,5-Diphenyl-2H-pyrazole-3-carboxylic acid
FD57108-02 500 mg

2,5-Diphenyl-2H-pyrazole-3-carboxylic acid

Sign In for Pricing
View Details