Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC86 Peptide - N-terminal region

CCDC86 Peptide - N-terminal region

Product Specifications

UniProt

Q9H6F5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC86 Rabbit Polyclonal Antibody (orb326747) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077003

Preservative

Lyophilized powder

AA Sequence

ESPQRQPEYSPESPRCQPKPSEEAPKCSQDQGVLASELAQNKEELTPGAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSB Broth Base
M941-500G 500 g

PSB Broth Base

Sign In for Pricing
View Details
Exendin-4 (Heloderma suspectum) - EIA Kit, CE Mark Certified
EK-070-94CE 96 Well

Exendin-4 (Heloderma suspectum) - EIA Kit, CE Mark Certified

Sign In for Pricing
View Details
1,4-bUtanedithiol-d8
HY-W157316S 1 mg

1,4-bUtanedithiol-d8

Sign In for Pricing
View Details
Recombinant Bla g 5 (v2)
E4A10Y16-v2 50 µg

Recombinant Bla g 5 (v2)

Sign In for Pricing
View Details
LOC100504635 3'UTR GFP Stable Cell Line
TU162122 1.0 mL

LOC100504635 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DUSP26 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV662232 1.0 µg DNA

DUSP26 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details