Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNIH2 Peptide - C-terminal region

CNIH2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CNIH-2, Cnil

UniProt

Q6PI25

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNIH2 Rabbit Polyclonal Antibody (orb586965) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872359

Preservative

Lyophilized powder

AA Sequence

LWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bulk Human IgG3 (IB3) Isotype Control
ICH2256-25mg 25 mg

Bulk Human IgG3 (IB3) Isotype Control

Sign In for Pricing
View Details
MOB4 Polyclonal Antibody
E-AB-52342-01 20 µL

MOB4 Polyclonal Antibody

Sign In for Pricing
View Details
MOB4 Polyclonal Antibody
E-AB-52342-02 60 µL

MOB4 Polyclonal Antibody

Sign In for Pricing
View Details
MOB4 Polyclonal Antibody
E-AB-52342-03 120 µL

MOB4 Polyclonal Antibody

Sign In for Pricing
View Details
MOB4 Polyclonal Antibody
E-AB-52342-04 200 µL

MOB4 Polyclonal Antibody

Sign In for Pricing
View Details
Stx7 Mouse Gene Knockout Kit (CRISPR)
KN516934 1 Kit

Stx7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details