Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CT45A1 Peptide - N-terminal region

CT45A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CT45, CT45-1, CT45.1

UniProt

Q5HYN5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CT45A1 Rabbit Polyclonal Antibody (orb586969) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017417

Preservative

Lyophilized powder

AA Sequence

VFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fblim1 (NM_001007554) Rat Untagged Clone
RN213830 10 µg

Fblim1 (NM_001007554) Rat Untagged Clone

Sign In for Pricing
View Details
PKNOX2 siRNA (Mouse)
MBS8238265-01 15 nmol

PKNOX2 siRNA (Mouse)

Sign In for Pricing
View Details
PKNOX2 siRNA (Mouse)
MBS8238265-02 30 nmol

PKNOX2 siRNA (Mouse)

Sign In for Pricing
View Details
PKNOX2 siRNA (Mouse)
MBS8238265-03 5x 30 nmol

PKNOX2 siRNA (Mouse)

Sign In for Pricing
View Details
TUBGCP2 (Gamma-tubulin Complex Component 2, GCP2, GCP-2, hGCP2, Gamma-ring Complex Protein 103kD, h103p, hGrip103, Grip103, Spindle Pole Body Protein Spc97 Homolog, SPBC97, Spc97p, hSpc97) (MaxLight 490)
134899-ML490 100 µL

TUBGCP2 (Gamma-tubulin Complex Component 2, GCP2, GCP-2, hGCP2, Gamma-ring Complex Protein 103kD, h103p, hGrip103, Grip103, Spindle Pole Body Protein Spc97 Homolog, SPBC97, Spc97p, hSpc97) (MaxLight 490)

Sign In for Pricing
View Details
Dsg3 shRNA Plasmid (h)
sc-43115-SH 20 µg

Dsg3 shRNA Plasmid (h)

Sign In for Pricing
View Details