Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CT45A1 Peptide - N-terminal region

CT45A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CT45, CT45-1, CT45.1

UniProt

Q5HYN5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CT45A1 Rabbit Polyclonal Antibody (orb586969) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017417

Preservative

Lyophilized powder

AA Sequence

VFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human Caspase-3 Polyclonal Antibody
CPBT-66278RH-01 10 µl*

Rabbit Anti Human Caspase-3 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti Human Caspase-3 Polyclonal Antibody
CPBT-66278RH-02 0.1 ml

Rabbit Anti Human Caspase-3 Polyclonal Antibody

Sign In for Pricing
View Details
Ferritin Light Chain Mouse Monoclonal Antibody
orb1727973-01 50 µL

Ferritin Light Chain Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Ferritin Light Chain Mouse Monoclonal Antibody
orb1727973-02 100 µL

Ferritin Light Chain Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Ferritin Light Chain Mouse Monoclonal Antibody
orb1727973-03 200 µL

Ferritin Light Chain Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Ferritin Light Chain Mouse Monoclonal Antibody
orb1727973-04 200 µg

Ferritin Light Chain Mouse Monoclonal Antibody

Sign In for Pricing
View Details