Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR157 Peptide - C-terminal region

GPR157 Peptide - C-terminal region

Product Specifications

UniProt

Q5UAW9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR157 Rabbit Polyclonal Antibody (orb587019) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079256

Preservative

Lyophilized powder

AA Sequence

VRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 3, Full-length (CPP-32, Apoptain, Yama, SCA-1) (MaxLight 750)
MBS6467491-01 0.1 mL

Caspase 3, Full-length (CPP-32, Apoptain, Yama, SCA-1) (MaxLight 750)

Sign In for Pricing
View Details
Caspase 3, Full-length (CPP-32, Apoptain, Yama, SCA-1) (MaxLight 750)
MBS6467491-02 5x 0.1 mL

Caspase 3, Full-length (CPP-32, Apoptain, Yama, SCA-1) (MaxLight 750)

Sign In for Pricing
View Details
CD62L antibody
10R-CD62DMS 0.5 mg

CD62L antibody

Sign In for Pricing
View Details
14-3-3 Rabbit Polyclonal Antibody (BF680)
orb1589956 100 µL

14-3-3 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
LMNB1 Peptide - middle region
orb1997512 100 µg

LMNB1 Peptide - middle region

Sign In for Pricing
View Details
MAPK1 Antibody Blocking peptide
orb1446832 500 µg

MAPK1 Antibody Blocking peptide

Sign In for Pricing
View Details