Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR173 Peptide - C-terminal region

GPR173 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SREB3

UniProt

Q9NS66

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR173 Rabbit Polyclonal Antibody (orb587021) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061842

Preservative

Lyophilized powder

AA Sequence

IRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWSPYIVACYWRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdkl2 Mouse Gene Knockout Kit (CRISPR)
KN503054 1 Kit

Cdkl2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UBA52 (NM_001033930) Human Over-expression Lysate
LY422429 100 µg

UBA52 (NM_001033930) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Phenylthio-5-propionylphenylacetic Acid
TRC-P337050-1G 1 g

2-Phenylthio-5-propionylphenylacetic Acid

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Polyclonal Antibody to Equine IgG,
AA-2355-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Polyclonal Antibody to Equine IgG,

Sign In for Pricing
View Details
Recombinant ERR alpha Antibody
RC-6898-01 50 μL

Recombinant ERR alpha Antibody

Sign In for Pricing
View Details
Recombinant ERR alpha Antibody
RC-6898-02 100 µL

Recombinant ERR alpha Antibody

Sign In for Pricing
View Details