Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR173 Peptide - C-terminal region

GPR173 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SREB3

UniProt

Q9NS66

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR173 Rabbit Polyclonal Antibody (orb587021) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061842

Preservative

Lyophilized powder

AA Sequence

IRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWSPYIVACYWRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL24 Human Gene Knockout Kit (CRISPR)
KN416502 1 Kit

IL24 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant BOK Antibody
RC-4324-01 50 μL

Recombinant BOK Antibody

Sign In for Pricing
View Details
Recombinant BOK Antibody
RC-4324-02 100 µL

Recombinant BOK Antibody

Sign In for Pricing
View Details
Recombinant BOK Antibody
RC-4324-03 1 mL

Recombinant BOK Antibody

Sign In for Pricing
View Details
AzoDye-2 Amine
2426-AAT 5 mg

AzoDye-2 Amine

Sign In for Pricing
View Details
Slc9b2 Mouse Gene Knockout Kit (CRISPR)
KN516218 1 Kit

Slc9b2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details