Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRAMD1B Peptide - N-terminal region

GRAMD1B Peptide - N-terminal region

Product Specifications

UniProt

Q3KR37

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRAMD1B Rabbit Polyclonal Antibody (orb587022) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065767

Preservative

Lyophilized powder

AA Sequence

SDHSSDKSPSTPEQGVQRSCSSQSGRSGGKNSKKSQSWYNVLSPTYKQRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOD1/Superoxide Dismutase Monoclonal Antibody
AN200019P 100 µL

SOD1/Superoxide Dismutase Monoclonal Antibody

Sign In for Pricing
View Details
2-Cyclohexylpropan-1-amine
TRC-C988543-10MG 10 mg

2-Cyclohexylpropan-1-amine

Sign In for Pricing
View Details
4-(4-Aminophenyl)butyric Acid
TRC-A622565-2.5G 2.5 g

4-(4-Aminophenyl)butyric Acid

Sign In for Pricing
View Details
Ccdc130 (BC021321) Mouse Tagged ORF Clone
MG201974 10 µg

Ccdc130 (BC021321) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Hsp22 (HSPB8) Mouse Monoclonal Antibody [Clone ID: 5B12]
AM31103PU-N 50 µg

Hsp22 (HSPB8) Mouse Monoclonal Antibody [Clone ID: 5B12]

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery: peripheral
CS626844 5x 5 µm

Frozen Tissue Sections, Artery: peripheral

Sign In for Pricing
View Details