Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRAMD1B Peptide - N-terminal region

GRAMD1B Peptide - N-terminal region

Product Specifications

UniProt

Q3KR37

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRAMD1B Rabbit Polyclonal Antibody (orb587022) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065767

Preservative

Lyophilized powder

AA Sequence

SDHSSDKSPSTPEQGVQRSCSSQSGRSGGKNSKKSQSWYNVLSPTYKQRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-100 1x 100 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human MORC3 activation kit by CRISPRa
GA108359 1 Kit

Human MORC3 activation kit by CRISPRa

Sign In for Pricing
View Details
p21 (CDKN1A) Rabbit Monoclonal Antibody
TA422238 100 µL

p21 (CDKN1A) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Sf3b3 (NM_133953) Mouse Recombinant Protein
TP511816 20 µg

Sf3b3 (NM_133953) Mouse Recombinant Protein

Sign In for Pricing
View Details
2-Deoxy-D-glucose
TRC-D239000-5G 5 g

2-Deoxy-D-glucose

Sign In for Pricing
View Details
XFD488 Hydroxylamine
1900-AAT 1 mg

XFD488 Hydroxylamine

Sign In for Pricing
View Details