Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HHLA1 Peptide - N-terminal region

HHLA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PLA2L

UniProt

C9JL84

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HHLA1 Rabbit Polyclonal Antibody (orb587024) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138567

Preservative

Lyophilized powder

AA Sequence

VSGIKGEAKKEKGMTFLPTTVSGLREEERKEKGVAFLATTELPARSIDLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benz[j]aceanthrylen-2(1H)-one13C2,d2 and Benz[e]aceanthrylen-6(5H)-one13C2,d2
TRC-B183543-1MG 1 mg

Benz[j]aceanthrylen-2(1H)-one13C2,d2 and Benz[e]aceanthrylen-6(5H)-one13C2,d2

Sign In for Pricing
View Details
(S)-7-Amino-5H,7H-dibenzo[b,d]azepin-6-one
TRC-A604380-1MG 1 mg

(S)-7-Amino-5H,7H-dibenzo[b,d]azepin-6-one

Sign In for Pricing
View Details
TAS2R44 (TAS2R31) Human Gene Knockout Kit (CRISPR)
KN423842 1 Kit

TAS2R44 (TAS2R31) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: right
CS808965 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS645983 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
3-Nitro-L-tyrosine-d3
TRC-N597002-25MG 25 mg

3-Nitro-L-tyrosine-d3

Sign In for Pricing
View Details