Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HHLA1 Peptide - N-terminal region

HHLA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PLA2L

UniProt

C9JL84

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HHLA1 Rabbit Polyclonal Antibody (orb587024) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138567

Preservative

Lyophilized powder

AA Sequence

VSGIKGEAKKEKGMTFLPTTVSGLREEERKEKGVAFLATTELPARSIDLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xanthine/Hypoxanthine Microplate Assay Kit
RDSM209 100 Assays

Xanthine/Hypoxanthine Microplate Assay Kit

Sign In for Pricing
View Details
Diacetyl-3,3’-Dinitrobenzidine
TRC-D327025-10G 10 g

Diacetyl-3,3’-Dinitrobenzidine

Sign In for Pricing
View Details
EDG3 (S1PR3) (NM_005226) Human Over-expression Lysate
LY401600 100 µg

EDG3 (S1PR3) (NM_005226) Human Over-expression Lysate

Sign In for Pricing
View Details
TMEM88 (NM_203411) Human Recombinant Protein
TP309280M 100 µg

TMEM88 (NM_203411) Human Recombinant Protein

Sign In for Pricing
View Details
L3MBTL2 Rabbit Polyclonal Antibody
TA366336 100 µL

L3MBTL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Neuroplastin (NPTN) ELISA Kit
RD-NPTN-Hu-01 96 Tests

Human Neuroplastin (NPTN) ELISA Kit

Sign In for Pricing
View Details