Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS1 Peptide - N-terminal region

INTS1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

INT1, NET28

UniProt

Q8N201

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INTS1 Rabbit Polyclonal Antibody (orb587027) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073922

Preservative

Lyophilized powder

AA Sequence

TVRRPSAAAKPSGHPPPGDFIALGSKGQANESKTASTLLKPAPSGLPSER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRP8/14 (S100A8/A9) Mouse Monoclonal Antibody [Clone ID: FP 64]
AM31907PU-N 100 µg

MRP8/14 (S100A8/A9) Mouse Monoclonal Antibody [Clone ID: FP 64]

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (13C4), CF594 conjugate, 0.1mg/mL
BNC940147-500 1x 500 µL

Pgp9.5 (UCHL-1) (13C4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF488A conjugate, 0.1mg/mL
BNC882316-500 1x 500 µL

Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STAT2 (STAT2/2650), CF488A conjugate, 0.1mg/mL
BNC882650-100 1x 100 µL

STAT2 (STAT2/2650), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CK-7 Polyclonal Antibody
D-AB-10469L-01 25 µL

CK-7 Polyclonal Antibody

Sign In for Pricing
View Details
CK-7 Polyclonal Antibody
D-AB-10469L-02 100 µL

CK-7 Polyclonal Antibody

Sign In for Pricing
View Details