Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFSD4B Peptide - middle region

MFSD4B Peptide - middle region

Product Specifications

Product Name Alternative

NaGLT1, KIAA1919

UniProt

Q5TF39

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MFSD4B Rabbit Polyclonal Antibody (orb326763) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_699200

Preservative

Lyophilized powder

AA Sequence

YAVIGTYMFLVSVIFFCLFLKNSSKQEKARASAETFRRAKYHNALLCLLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Max-interacting protein 1 MXI1 Antibody
A08708 100 µL

Anti-Max-interacting protein 1 MXI1 Antibody

Sign In for Pricing
View Details
Anti-OCM Polyclonal Antibody
HY361014-01 50 µg

Anti-OCM Polyclonal Antibody

Sign In for Pricing
View Details
Anti-OCM Polyclonal Antibody
HY361014-02 100 µg

Anti-OCM Polyclonal Antibody

Sign In for Pricing
View Details
WISP1 Protein Vector (Rat) (pPM-C-His)
PV316597 500 ng

WISP1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
PLV3-U6-ZEB2-shRNA3-EGFP-Puro Plasmid
PVT75199 2 µg

PLV3-U6-ZEB2-shRNA3-EGFP-Puro Plasmid

Sign In for Pricing
View Details
Human nudix hydrolase 15 (NUDT15) ELISA Kit
YP-W100555-01 48 Tests

Human nudix hydrolase 15 (NUDT15) ELISA Kit

Sign In for Pricing
View Details