Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT73 Peptide - C-terminal region

KRT73 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IRT6IRS3, K6IRS3, KRT6IRS3

UniProt

Q86Y46

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT73 Rabbit Polyclonal Antibody (orb587031) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_778238

Preservative

Lyophilized powder

AA Sequence

YSMLPGGCVTGSGNCSPRGEARTRLGSASEFRDSQGKTLALSSPTKKTMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SOX2 Antibody [Allophycocyanin]
NB110-37235APC 0.1 mL

Rabbit Polyclonal SOX2 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
KLF11 Antibody
MBS9600250-01 0.1 mL

KLF11 Antibody

Sign In for Pricing
View Details
KLF11 Antibody
MBS9600250-02 0.2 mL

KLF11 Antibody

Sign In for Pricing
View Details
KLF11 Antibody
MBS9600250-03 5x 0.2 mL

KLF11 Antibody

Sign In for Pricing
View Details
ZFHX4 (Zinc Finger Homeobox Protein 4, Zinc Finger Homeodomain Protein 4, ZFH-4, ZHF4) (MaxLight 405)
MBS6193477-01 0.1 mL

ZFHX4 (Zinc Finger Homeobox Protein 4, Zinc Finger Homeodomain Protein 4, ZFH-4, ZHF4) (MaxLight 405)

Sign In for Pricing
View Details
ZFHX4 (Zinc Finger Homeobox Protein 4, Zinc Finger Homeodomain Protein 4, ZFH-4, ZHF4) (MaxLight 405)
MBS6193477-02 5x 0.1 mL

ZFHX4 (Zinc Finger Homeobox Protein 4, Zinc Finger Homeodomain Protein 4, ZFH-4, ZHF4) (MaxLight 405)

Sign In for Pricing
View Details