Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT73 Peptide - C-terminal region

KRT73 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IRT6IRS3, K6IRS3, KRT6IRS3

UniProt

Q86Y46

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT73 Rabbit Polyclonal Antibody (orb587031) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_778238

Preservative

Lyophilized powder

AA Sequence

YSMLPGGCVTGSGNCSPRGEARTRLGSASEFRDSQGKTLALSSPTKKTMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human KDM5B shRNA (UAS) - Lentiviral human KDM5B shRNA (UAS) plasmid
GTR15325858 1 Vial

Lentiviral human KDM5B shRNA (UAS) - Lentiviral human KDM5B shRNA (UAS) plasmid

Sign In for Pricing
View Details
Conductivity Std 60000uS/cm at 25C
CSKC60M 500 mL

Conductivity Std 60000uS/cm at 25C

Sign In for Pricing
View Details
Zfp157 Recombinant Protein (Mouse)
RP186674 100 µg

Zfp157 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
GMCL1P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV762274 1.0 µg DNA

GMCL1P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Chlorahololide C
orb1682959 5 mg

Chlorahololide C

Sign In for Pricing
View Details
NXN Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
32364064 1.0 µg DNA

NXN Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details