Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT80 Peptide - N-terminal region

KRT80 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KB20

UniProt

Q6KB66

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT80 Rabbit Polyclonal Antibody (orb587033) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074961

Preservative

Lyophilized powder

AA Sequence

KVTVNPGLLVPLDVKLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF348/Kaiso Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-62183R-BF680 100 µL

ZNF348/Kaiso Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
6-Ethoxy-3,4-dihydro-2H-1-benzopyran-3-carboxylic acid
YLB12064-01 50 mg

6-Ethoxy-3,4-dihydro-2H-1-benzopyran-3-carboxylic acid

Sign In for Pricing
View Details
6-Ethoxy-3,4-dihydro-2H-1-benzopyran-3-carboxylic acid
YLB12064-02 0.5 g

6-Ethoxy-3,4-dihydro-2H-1-benzopyran-3-carboxylic acid

Sign In for Pricing
View Details
TSPAN4 Polyclonal Antibody
MBS9130764-01 0.02 mL

TSPAN4 Polyclonal Antibody

Sign In for Pricing
View Details
TSPAN4 Polyclonal Antibody
MBS9130764-02 0.1 mL

TSPAN4 Polyclonal Antibody

Sign In for Pricing
View Details
TSPAN4 Polyclonal Antibody
MBS9130764-03 5x 0.1 mL

TSPAN4 Polyclonal Antibody

Sign In for Pricing
View Details