Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT80 Peptide - N-terminal region

KRT80 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KB20

UniProt

Q6KB66

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT80 Rabbit Polyclonal Antibody (orb587033) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074961

Preservative

Lyophilized powder

AA Sequence

KVTVNPGLLVPLDVKLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pUNO1-SpikeV3-dfur
p1-spike-v3-df 20 µg

pUNO1-SpikeV3-dfur

Sign In for Pricing
View Details
C-Kit-IN-3 hydrochloride
orb1706250-01 25 mg

C-Kit-IN-3 hydrochloride

Sign In for Pricing
View Details
C-Kit-IN-3 hydrochloride
orb1706250-02 50 mg

C-Kit-IN-3 hydrochloride

Sign In for Pricing
View Details
C-Kit-IN-3 hydrochloride
orb1706250-03 100 mg

C-Kit-IN-3 hydrochloride

Sign In for Pricing
View Details
ENOSF1 Lentiviral Activation Particles (h)
sc-412546-LAC 200 µL

ENOSF1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) RSGA Polyclonal Antibody
MBS7178278 Inquire

Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) RSGA Polyclonal Antibody

Sign In for Pricing
View Details