Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENTR1 Peptide - C-terminal region

ENTR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NY-CO-3, SDCCAG3

UniProt

Q96C92

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENTR1 Rabbit Polyclonal Antibody (orb587045) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006634

Preservative

Lyophilized powder

AA Sequence

PAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSKLRRKLNEVQSFSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDNF Rabbit Polyclonal Antibody
TA376535 100 µL

GDNF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ethylene Glycol Bis (β-aminoethylether) -N, N, N', N'-tetraacetic Acid
15214-92 25 g

Ethylene Glycol Bis (β-aminoethylether) -N, N, N', N'-tetraacetic Acid

Sign In for Pricing
View Details
Antitubercular agent-35
orb1982417-01 5 mg

Antitubercular agent-35

Sign In for Pricing
View Details
Antitubercular agent-35
orb1982417-02 50 mg

Antitubercular agent-35

Sign In for Pricing
View Details
Rabbit Polyclonal KCNN4 Antibody
NBP3-04926-20ul 20 µL

Rabbit Polyclonal KCNN4 Antibody

Sign In for Pricing
View Details
Human MAGE-A4 Protein, hFc Tag
MBS188393-01 0.01 mg

Human MAGE-A4 Protein, hFc Tag

Sign In for Pricing
View Details