Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENTR1 Peptide - C-terminal region

ENTR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NY-CO-3, SDCCAG3

UniProt

Q96C92

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENTR1 Rabbit Polyclonal Antibody (orb587045) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006634

Preservative

Lyophilized powder

AA Sequence

PAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSKLRRKLNEVQSFSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR4S2 shRNA Plasmid
abx966376-01 150 µg

Human OR4S2 shRNA Plasmid

Sign In for Pricing
View Details
Human OR4S2 shRNA Plasmid
abx966376-02 300 µg

Human OR4S2 shRNA Plasmid

Sign In for Pricing
View Details
MSRA Polyclonal Antibody
MBS2538425-01 0.06 mL

MSRA Polyclonal Antibody

Sign In for Pricing
View Details
MSRA Polyclonal Antibody
MBS2538425-02 0.12 mL

MSRA Polyclonal Antibody

Sign In for Pricing
View Details
MSRA Polyclonal Antibody
MBS2538425-03 0.2 mL

MSRA Polyclonal Antibody

Sign In for Pricing
View Details
MSRA Polyclonal Antibody
MBS2538425-04 5x 0.2 mL

MSRA Polyclonal Antibody

Sign In for Pricing
View Details