Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT3 Peptide - middle region

NUDT3 Peptide - middle region

Product Specifications

Product Name Alternative

DIPP, DIPP-1, DIPP1

UniProt

O95989

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT3 Rabbit Polyclonal Antibody (orb587046) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006694

Preservative

Lyophilized powder

AA Sequence

VKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4B Rabbit Monoclonal Antibody [Clone ID: R05-4B2]
TA421693 100 µL

EIF4B Rabbit Monoclonal Antibody [Clone ID: R05-4B2]

Sign In for Pricing
View Details
TRAF6 Rabbit Polyclonal Antibody
R1311-2 100 µL

TRAF6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
E Cadherin (CDH1) Rabbit Polyclonal Antibody
AP06093PU-N 100 µg

E Cadherin (CDH1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TentaGel® S PAL
S30022.25G 25 g

TentaGel® S PAL

Sign In for Pricing
View Details
PDE9A (NM_001001568) Human Recombinant Protein
TP324133 20 µg

PDE9A (NM_001001568) Human Recombinant Protein

Sign In for Pricing
View Details
CCDC85C (NM_001144995) Human Over-expression Lysate
LY428630 100 µg

CCDC85C (NM_001144995) Human Over-expression Lysate

Sign In for Pricing
View Details