Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT3 Peptide - middle region

NUDT3 Peptide - middle region

Product Specifications

Product Name Alternative

DIPP, DIPP-1, DIPP1

UniProt

O95989

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT3 Rabbit Polyclonal Antibody (orb587046) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006694

Preservative

Lyophilized powder

AA Sequence

VKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2AC8 Rabbit Polyclonal Antibody
TA384361 100 µL

H2AC8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(4R)-5-(3',4'-Dihydroxyphenyl)-Gamma-valerolactone ((-)-Epicatechin Metabolite)
TRC-D454525-5MG 5 mg

(4R)-5-(3',4'-Dihydroxyphenyl)-Gamma-valerolactone ((-)-Epicatechin Metabolite)

Sign In for Pricing
View Details
TMPRSS11D Polyclonal Antibody
E-AB-17120-01 20 µL

TMPRSS11D Polyclonal Antibody

Sign In for Pricing
View Details
TMPRSS11D Polyclonal Antibody
E-AB-17120-02 60 µL

TMPRSS11D Polyclonal Antibody

Sign In for Pricing
View Details
TMPRSS11D Polyclonal Antibody
E-AB-17120-03 120 µL

TMPRSS11D Polyclonal Antibody

Sign In for Pricing
View Details
TMPRSS11D Polyclonal Antibody
E-AB-17120-04 200 µL

TMPRSS11D Polyclonal Antibody

Sign In for Pricing
View Details