Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH2 Peptide - C-terminal region

NXPH2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NPH2

UniProt

O95156

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NXPH2 Rabbit Polyclonal Antibody (orb587047) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009157

Preservative

Lyophilized powder

AA Sequence

VPPSKVVEFEVSPQSTLETKESKSFNCRIEYEKTDRAKKTALCNFDPSKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSC 319726 (ZMC1)
S7149-25mg 25 mg

NSC 319726 (ZMC1)

Sign In for Pricing
View Details
Rabbit Polyclonal O-GlcNAcase/OGA/MGEA5 Antibody [Alexa Fluor 700]
NBP2-32233AF700 0.1 mL

Rabbit Polyclonal O-GlcNAcase/OGA/MGEA5 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
pOTB7-RPL21 Plasmid
PVT24112 2 µg

pOTB7-RPL21 Plasmid

Sign In for Pricing
View Details
Cavy Heat Shock 70Kda Protein 5 ELISA Kit
MBS043817 Inquire

Cavy Heat Shock 70Kda Protein 5 ELISA Kit

Sign In for Pricing
View Details
Olfr1537 Mouse qPCR Primer Pair (NM_207665)
MP209636 200 Reactions

Olfr1537 Mouse qPCR Primer Pair (NM_207665)

Sign In for Pricing
View Details
Human cytokeratin 20, CK-20 ELISA Kit
CK-bio-11168-01 48 Tests

Human cytokeratin 20, CK-20 ELISA Kit

Sign In for Pricing
View Details