Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH2 Peptide - C-terminal region

NXPH2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NPH2

UniProt

O95156

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NXPH2 Rabbit Polyclonal Antibody (orb587047) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009157

Preservative

Lyophilized powder

AA Sequence

VPPSKVVEFEVSPQSTLETKESKSFNCRIEYEKTDRAKKTALCNFDPSKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TULP1 shRNA (UAS) - Lentiviral human TULP1 shRNA (UAS, RFP) (100)
GTR15098076 1 Vial

Lentiviral human TULP1 shRNA (UAS) - Lentiviral human TULP1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
NGDN, ID (NGDN, C14orf120, Neuroguidin, EIF4E-binding protein) (AP)
MBS6325180-01 0.2 mL

NGDN, ID (NGDN, C14orf120, Neuroguidin, EIF4E-binding protein) (AP)

Sign In for Pricing
View Details
NGDN, ID (NGDN, C14orf120, Neuroguidin, EIF4E-binding protein) (AP)
MBS6325180-02 5x 0.2 mL

NGDN, ID (NGDN, C14orf120, Neuroguidin, EIF4E-binding protein) (AP)

Sign In for Pricing
View Details
Biosan, Adapter for R-2
1216817 1 Unit

Biosan, Adapter for R-2

Sign In for Pricing
View Details
ERBB2 Antibody
orb689130-01 50 μL

ERBB2 Antibody

Sign In for Pricing
View Details
ERBB2 Antibody
orb689130-02 100 µL

ERBB2 Antibody

Sign In for Pricing
View Details