Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZC3H13 Peptide - C-terminal region

ZC3H13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0853

UniProt

Q5T200

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZC3H13 Rabbit Polyclonal Antibody (orb587048) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055885

Preservative

Lyophilized powder

AA Sequence

GSGAGEGYEPISDDELDEILAGDAEKREDQQDEEKMPDPLDVIDVDWSGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
BNC740391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-500 1x 500 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-500 1x 500 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-100 1x 100 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-100 1x 100 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF647 conjugate, 0.1mg/mL
BNC471045-500 1x 500 µL

CD16 (C16/1045), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details