Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTLL12 Peptide - N-terminal region

TTLL12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DJ526I14.2

UniProt

Q14166

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTLL12 Rabbit Polyclonal Antibody (orb326768) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055955

Preservative

Lyophilized powder

AA Sequence

PAERSSPGQTPEEGAQALAEFAALHGPALRASGVPERYWGRLLHKLEHEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HS3ST3B1 Antibody
RN-12579-01 50 μL

Recombinant HS3ST3B1 Antibody

Sign In for Pricing
View Details
Recombinant HS3ST3B1 Antibody
RN-12579-02 100 µL

Recombinant HS3ST3B1 Antibody

Sign In for Pricing
View Details
Recombinant HS3ST3B1 Antibody
RN-12579-03 1 mL

Recombinant HS3ST3B1 Antibody

Sign In for Pricing
View Details
NKX1-2 (NM_001146340) Human Over-expression Lysate
LC431272 20 µg

NKX1-2 (NM_001146340) Human Over-expression Lysate

Sign In for Pricing
View Details
DGAT2L3 (AWAT1) Human Gene Knockout Kit (CRISPR)
KN421837 1 Kit

DGAT2L3 (AWAT1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Maleimide PCR Plates - semi skirted
PCR960222-MAL 10 Plates

Maleimide PCR Plates - semi skirted

Sign In for Pricing
View Details