Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTLL12 Peptide - N-terminal region

TTLL12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DJ526I14.2

UniProt

Q14166

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTLL12 Rabbit Polyclonal Antibody (orb326768) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055955

Preservative

Lyophilized powder

AA Sequence

PAERSSPGQTPEEGAQALAEFAALHGPALRASGVPERYWGRLLHKLEHEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene A RAM
HA12516023.5G 5 g

Polystyrene A RAM

Sign In for Pricing
View Details
Human ZNF765 activation kit by CRISPRa
GA114137 1 Kit

Human ZNF765 activation kit by CRISPRa

Sign In for Pricing
View Details
SS18 (NM_001007559) Human Over-expression Lysate
LY423511 100 µg

SS18 (NM_001007559) Human Over-expression Lysate

Sign In for Pricing
View Details
rac a-Lipoic Acid
TRC-L468750-500MG 500 mg

rac a-Lipoic Acid

Sign In for Pricing
View Details
Aaas Mouse Gene Knockout Kit (CRISPR)
KN500574 1 Kit

Aaas Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BCAS4 (NM_017843) Human Recombinant Protein
TP315772M 100 µg

BCAS4 (NM_017843) Human Recombinant Protein

Sign In for Pricing
View Details