Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTLL12 Peptide - N-terminal region

TTLL12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DJ526I14.2

UniProt

Q14166

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTLL12 Rabbit Polyclonal Antibody (orb326768) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055955

Preservative

Lyophilized powder

AA Sequence

PAERSSPGQTPEEGAQALAEFAALHGPALRASGVPERYWGRLLHKLEHEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-4 (Interleukin-4), Mouse (11B11), CF640R conjugate, 0.1mg/mL
BNC402008-500 1x 500 µL

IL-4 (Interleukin-4), Mouse (11B11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nagk (NM_001164187) Mouse Recombinant Protein
TP505154 20 µg

Nagk (NM_001164187) Mouse Recombinant Protein

Sign In for Pricing
View Details
MTHFD2 (NM_006636) Human Over-expression Lysate
LC401984 20 µg

MTHFD2 (NM_006636) Human Over-expression Lysate

Sign In for Pricing
View Details
NT5C3 Antibody
8C11674-AAT 50 µg

NT5C3 Antibody

Sign In for Pricing
View Details
Recombinant Mouse TETHERIN/BST2 Protein (Fc Tag)
PKSM040379 50 µg

Recombinant Mouse TETHERIN/BST2 Protein (Fc Tag)

Sign In for Pricing
View Details
Coprostan-3-ol
TRC-C685450-25MG 25 mg

Coprostan-3-ol

Sign In for Pricing
View Details