Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POTEH Peptide - C-terminal region

POTEH Peptide - C-terminal region

Product Specifications

Product Name Alternative

A26C3, ACTBL1, CT104.7, POTE22

UniProt

Q6S545

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POTEH Rabbit Polyclonal Antibody (orb587053) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129685

Preservative

Lyophilized powder

AA Sequence

EEESQRLKGSENSQPEEMSQEPEINKGGDRKVEEEMKKHGSTHMGFPENL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rec8 Blocking Peptide
33R-7641 0.1 mg

Rec8 Blocking Peptide

Sign In for Pricing
View Details
Camel Venom Factor (VF) ELISA Kit
MBS9917075-01 48 Well

Camel Venom Factor (VF) ELISA Kit

Sign In for Pricing
View Details
Camel Venom Factor (VF) ELISA Kit
MBS9917075-02 96 Well

Camel Venom Factor (VF) ELISA Kit

Sign In for Pricing
View Details
Camel Venom Factor (VF) ELISA Kit
MBS9917075-03 5x 96 Well

Camel Venom Factor (VF) ELISA Kit

Sign In for Pricing
View Details
Camel Venom Factor (VF) ELISA Kit
MBS9917075-04 10x 96 Well

Camel Venom Factor (VF) ELISA Kit

Sign In for Pricing
View Details
Methyl 3- (6-bromo-5-pivalamidopyridin-3-yl) -acrylate
455082-01 25 mg

Methyl 3- (6-bromo-5-pivalamidopyridin-3-yl) -acrylate

Sign In for Pricing
View Details