Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR7A5 Peptide - C-terminal region

OR7A5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HTPCR2

UniProt

Q15622

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR7A5 Rabbit Polyclonal Antibody (orb587056) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059976

Preservative

Lyophilized powder

AA Sequence

YLSSAATRNSHSSATASVMYTVVTPMLNPFIYSLRNKDIKRALGIHLLWG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCPTP1 (PTPRR) (NM_130846) Human Recombinant Protein
TP311122M 100 µg

PCPTP1 (PTPRR) (NM_130846) Human Recombinant Protein

Sign In for Pricing
View Details
RHCG Polyclonal Antibody
E-AB-53325-01 20 µL

RHCG Polyclonal Antibody

Sign In for Pricing
View Details
RHCG Polyclonal Antibody
E-AB-53325-02 60 µL

RHCG Polyclonal Antibody

Sign In for Pricing
View Details
RHCG Polyclonal Antibody
E-AB-53325-03 120 µL

RHCG Polyclonal Antibody

Sign In for Pricing
View Details
RHCG Polyclonal Antibody
E-AB-53325-04 200 µL

RHCG Polyclonal Antibody

Sign In for Pricing
View Details
p53 (TP53) pSer392 Mouse Monoclonal Antibody [Clone ID: FP3.2]
AM03100PU-N 100 µg

p53 (TP53) pSer392 Mouse Monoclonal Antibody [Clone ID: FP3.2]

Sign In for Pricing
View Details