Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY10 Peptide - N-terminal region

P2RY10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P2Y10

UniProt

O00398

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RY10 Rabbit Polyclonal Antibody (orb587058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055314

Preservative

Lyophilized powder

AA Sequence

NLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Neb shRNA (UAS) - Lentiviral mouseNeb shRNA (UAS, GFP) (25)
GTR15272336 1 Vial

Lentiviral mouse Neb shRNA (UAS) - Lentiviral mouseNeb shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
CDK2AP1 Antibody, Biotin conjugated
CSB-PA005062DD01HU-01 50 µg

CDK2AP1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CDK2AP1 Antibody, Biotin conjugated
CSB-PA005062DD01HU-02 100 µg

CDK2AP1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) ; Clone CFTR/1341 (Concentrate)
RA0497-C.1 0.1 mL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) ; Clone CFTR/1341 (Concentrate)

Sign In for Pricing
View Details
Folate Binding Protein, Bovine
MBS634513-01 1 mg

Folate Binding Protein, Bovine

Sign In for Pricing
View Details
Folate Binding Protein, Bovine
MBS634513-02 5x 1 mg

Folate Binding Protein, Bovine

Sign In for Pricing
View Details