Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY10 Peptide - N-terminal region

P2RY10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P2Y10

UniProt

O00398

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RY10 Rabbit Polyclonal Antibody (orb587058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055314

Preservative

Lyophilized powder

AA Sequence

NLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TNNT3 antibody
STJ191557 200 µl

Anti-TNNT3 antibody

Sign In for Pricing
View Details
Human OOSP3 Pre-designed siRNA Set B
SI011063B 1 Each

Human OOSP3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CANX Antibody
orb520418-01 50 μL

CANX Antibody

Sign In for Pricing
View Details
CANX Antibody
orb520418-02 100 µL

CANX Antibody

Sign In for Pricing
View Details
PRICKLE3 Protein Vector (Mouse) (pPM-C-HA)
37614024 500 ng

PRICKLE3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human SCO spondin (SSPO) ELISA Kit
GTR10357098 96 Well

Human SCO spondin (SSPO) ELISA Kit

Sign In for Pricing
View Details