Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAS2R3 Peptide - C-terminal region

TAS2R3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

T2R3

UniProt

Q9NYW6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAS2R3 Rabbit Polyclonal Antibody (orb587062) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058639

Preservative

Lyophilized powder

AA Sequence

RQMLQNGTSSRDPTTEAHKRAIRIILSFFFLFLLYFLAFLIASFGNFLPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Myosin heavy chain 11 Antibody (ID8) - Azide and BSA Free
NBP2-47899-0.1mg 0.1 mg

Mouse Monoclonal Myosin heavy chain 11 Antibody (ID8) - Azide and BSA Free

Sign In for Pricing
View Details
Laminin subunit beta-4/LAMB4 Rabbit Polyclonal Antibody (Cy3)
orb984951 100 µL

Laminin subunit beta-4/LAMB4 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
SULF2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2312105 3x 1.0 µg

SULF2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 UPF0482 protein ynfB (ynfB)
MBS7093993-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O157:H7 UPF0482 protein ynfB (ynfB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 UPF0482 protein ynfB (ynfB)
MBS7093993-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O157:H7 UPF0482 protein ynfB (ynfB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 UPF0482 protein ynfB (ynfB)
MBS7093993-03 0.02 mg (Yeast)

Recombinant Escherichia coli O157:H7 UPF0482 protein ynfB (ynfB)

Sign In for Pricing
View Details