Tbx4 Peptide - N-terminal region
Tbx4 Peptide - N-terminal region
Product Specifications
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tbx4 Rabbit Polyclonal Antibody (orb574801) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
D4A0A2
Preservative
Lyophilized powder
AA Sequence
DKGLSESEEAFRAPGPALGETSNSNNTNVPEPALATPGLSGTALSSPPGQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1762-100 1x 100 µL
Bcl-X (Apoptosis Marker) (BCL2L1/1762), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-C374977-1MG 1 mg
9-Chlorophenanthrene-13C6 (mixture of 2 isomers, Contain 4.2% unlabeled)
Sign In for Pricing
View Details 
CS631046 5x 5 µm
Frozen Tissue Sections, Multiple urinary system sites
Sign In for Pricing
View Details 
