Tbx4 Peptide - N-terminal region
Tbx4 Peptide - N-terminal region
Product Specifications
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tbx4 Rabbit Polyclonal Antibody (orb574801) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
D4A0A2
Preservative
Lyophilized powder
AA Sequence
DKGLSESEEAFRAPGPALGETSNSNNTNVPEPALATPGLSGTALSSPPGQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
