Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbm8a Peptide - N-terminal region

Rbm8a Peptide - N-terminal region

Product Specifications

Product Name Alternative

Rbm8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rbm8a Rabbit Polyclonal Antibody (orb577667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q27W01

Preservative

Lyophilized powder

AA Sequence

EDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACR1 Antibody - C-terminal region
ARP77913_P050-25UL 25 µL

TACR1 Antibody - C-terminal region

Sign In for Pricing
View Details
WDYHV1 Over-expression Lysate Product
GWB-37E0E6 0.1 mg

WDYHV1 Over-expression Lysate Product

Sign In for Pricing
View Details
Rat Monoclonal Perforin Antibody (CB5.4) [Alexa Fluor 350]
NBP1-97512AF350 0.1 mL

Rat Monoclonal Perforin Antibody (CB5.4) [Alexa Fluor 350]

Sign In for Pricing
View Details
LIN28B Polyclonal Antibody, FITC Conjugated
bs-6446R-FITC 100 µL

LIN28B Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Dstn (NM_001033666) Rat Tagged ORF Clone Lentiviral Particle
RR208718L3V 200 µL

Dstn (NM_001033666) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LYPD6B Lentiviral Activation Particles (m2)
sc-428127-LAC-2 200 µL

LYPD6B Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details