Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rrp7a Peptide - C-terminal region

Rrp7a Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cgi-96, RGD1311547

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rrp7a Rabbit Polyclonal Antibody (orb577788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

D4AE65

Preservative

Lyophilized powder

AA Sequence

KERRKRARKELLSFYAWQHRETKMEHLAQLRKKFEEDKQRIELMRAQRKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANGAP1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61906R-BF350-01 20 µL

RANGAP1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
RANGAP1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61906R-BF350-02 100 µL

RANGAP1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
LOC681958 3'UTR GFP Stable Cell Line
TU260826 1.0 mL

LOC681958 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human BAX (Apoptosis regulator BAX) ELISA Kit
EH0669 96 Tests

Human BAX (Apoptosis regulator BAX) ELISA Kit

Sign In for Pricing
View Details
Cyclin E1 (Phospho-T77) Antibody
MBS9431066-01 0.05 mL

Cyclin E1 (Phospho-T77) Antibody

Sign In for Pricing
View Details
Cyclin E1 (Phospho-T77) Antibody
MBS9431066-02 0.1 mL

Cyclin E1 (Phospho-T77) Antibody

Sign In for Pricing
View Details