B4GAT1 Peptide - middle region
B4GAT1 Peptide - middle region
Product Specifications
Product Name Alternative
IGAT, iGNT, B3gnt1, B3gnt6, BETA3GNT1, 1500032M01Rik
UniProt
Q8BWP8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with B4GAT1 Rabbit Polyclonal Antibody (orb579881) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_780592
Preservative
Lyophilized powder
AA Sequence
RYEAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYALGTNTSYPNNL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
SPD-C525d-1mg 1 mg
SARS-CoV-2 Spike RBD Protein (L452R, E484Q), Fc Tag (MALS verified)
Sign In for Pricing
View Details 
![Elab Fluor® 488 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]](https://cdn.genprice.uk/products/763/68dd14af061270361e7d38e2/imageurl/e-ab-f1028l.webp)
E-AB-F1028L-01 50 Tests
Elab Fluor® 488 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
Sign In for Pricing
View Details E-AB-F1028L-02 100 Tests
Elab Fluor® 488 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
Sign In for Pricing
View Details E-AB-F1028L-03 2x 100 Tests
Elab Fluor® 488 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
Sign In for Pricing
View Details