Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GAT1 Peptide - middle region

B4GAT1 Peptide - middle region

Product Specifications

Product Name Alternative

IGAT, iGNT, B3gnt1, B3gnt6, BETA3GNT1, 1500032M01Rik

UniProt

Q8BWP8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with B4GAT1 Rabbit Polyclonal Antibody (orb579881) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_780592

Preservative

Lyophilized powder

AA Sequence

RYEAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYALGTNTSYPNNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plaur (BC010309) Mouse Over-expression Lysate
LC702555 20 µg

Plaur (BC010309) Mouse Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB622134 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Benfluorex Hydrochloride
TRC-B135000-25MG 25 mg

Benfluorex Hydrochloride

Sign In for Pricing
View Details
SOX10 (SOX10/991 + SOX10/1074), Biotin conjugate, 0.1mg/mL
BNCB1074-500 1x 500 µL

SOX10 (SOX10/991 + SOX10/1074), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]
E-AB-F1131M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]
E-AB-F1131M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]

Sign In for Pricing
View Details