Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEK2 Peptide - N-terminal region

NEK2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HsPK21, NEK2A, NLK1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NEK2 Rabbit Polyclonal Antibody (orb580455) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

P51955

Preservative

Lyophilized powder

AA Sequence

RCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLK1 Polyclonal Antibody
ABP55249-01 30 µL

MLK1 Polyclonal Antibody

Sign In for Pricing
View Details
MLK1 Polyclonal Antibody
ABP55249-02 100 µL

MLK1 Polyclonal Antibody

Sign In for Pricing
View Details
MLK1 Polyclonal Antibody
ABP55249-03 200 µL

MLK1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse PHB Protein, N-His
orb3056374-01 50 µg

Recombinant Mouse PHB Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse PHB Protein, N-His
orb3056374-02 100 µg

Recombinant Mouse PHB Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse PHB Protein, N-His
orb3056374-03 1 mg

Recombinant Mouse PHB Protein, N-His

Sign In for Pricing
View Details