Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nmt2 Peptide - C-terminal region

Nmt2 Peptide - C-terminal region

Product Specifications

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nmt2 Rabbit Polyclonal Antibody (orb580473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q700Q7

Preservative

Lyophilized powder

AA Sequence

FDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Muted (BLOC1S5) (NM_001199323) Human Tagged ORF Clone
RC235550 10 µg

Muted (BLOC1S5) (NM_001199323) Human Tagged ORF Clone

Sign In for Pricing
View Details
PCSK9 Inhibitor, EGF-A
HY-P11071 1 Each

PCSK9 Inhibitor, EGF-A

Sign In for Pricing
View Details
Mouse GDP-fucose protein O-fucosyltransferase 2 (POFUT2) ELISA Kit
abx536718 96 Tests

Mouse GDP-fucose protein O-fucosyltransferase 2 (POFUT2) ELISA Kit

Sign In for Pricing
View Details
CCL15 (C-C Motif Chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage Inflammatory Protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible Cytokine A15, MIP5, NCC3, SCYA15) (MaxLight 750) discontinued
124447-ML750 100 µL

CCL15 (C-C Motif Chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage Inflammatory Protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible Cytokine A15, MIP5, NCC3, SCYA15) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MYBPC2 Antibody, FITC conjugated
A55007-100UG 100 µg

MYBPC2 Antibody, FITC conjugated

Sign In for Pricing
View Details
Rat SIR5 ELISA Kit
E105636 1 Each

Rat SIR5 ELISA Kit

Sign In for Pricing
View Details