Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nmt2 Peptide - C-terminal region

Nmt2 Peptide - C-terminal region

Product Specifications

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nmt2 Rabbit Polyclonal Antibody (orb580473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q700Q7

Preservative

Lyophilized powder

AA Sequence

FDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IAB15
MBS5803372 Inquire

IAB15

Sign In for Pricing
View Details
HPC1 Adenovirus (Human)
23852051 1.0 mL

HPC1 Adenovirus (Human)

Sign In for Pricing
View Details
Anti-DUSP12 Antibody Picoband® PE Conjugated
A08406-1-PE 100 µg/Vial

Anti-DUSP12 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
UPAR Monoclonal Antibody (Capture)
AN002100P-01 25 µg

UPAR Monoclonal Antibody (Capture)

Sign In for Pricing
View Details
UPAR Monoclonal Antibody (Capture)
AN002100P-02 100 µg

UPAR Monoclonal Antibody (Capture)

Sign In for Pricing
View Details
UPAR Monoclonal Antibody (Capture)
AN002100P-03 1 mg

UPAR Monoclonal Antibody (Capture)

Sign In for Pricing
View Details