Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clmp Peptide - N-terminal region

Clmp Peptide - N-terminal region

Product Specifications

Product Name Alternative

ACAM, Asam, Ol16

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Clmp Rabbit Polyclonal Antibody (orb325520) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q8K1G0

Preservative

Lyophilized powder

AA Sequence

LWLVTYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX3 Goat Polyclonal Antibody
AP31952PU-N 100 µg

PAX3 Goat Polyclonal Antibody

Sign In for Pricing
View Details
SSH3BP1 (ABI1) (NM_001178116) Human Over-expression Lysate
LY433176 100 µg

SSH3BP1 (ABI1) (NM_001178116) Human Over-expression Lysate

Sign In for Pricing
View Details
ATP5F1D (NM_001001975) Human Over-expression Lysate
LY424304 100 µg

ATP5F1D (NM_001001975) Human Over-expression Lysate

Sign In for Pricing
View Details
TCL1B Antibody
KC-1314-01 50 μL

TCL1B Antibody

Sign In for Pricing
View Details
TCL1B Antibody
KC-1314-02 100 µL

TCL1B Antibody

Sign In for Pricing
View Details
TCL1B Antibody
KC-1314-03 1 mL

TCL1B Antibody

Sign In for Pricing
View Details