Clmp Peptide - N-terminal region
Clmp Peptide - N-terminal region
Product Specifications
Product Name Alternative
ACAM, Asam, Ol16
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Clmp Rabbit Polyclonal Antibody (orb325520) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
Q8K1G0
Preservative
Lyophilized powder
AA Sequence
LWLVTYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682644-100 1x 100 µL
Prolactin (Pituitary Tumor Marker) (PRL/2644), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![HDAC10 Recombinant Rabbit Monoclonal Antibody [SD08-11]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea81ea4/imageurl/et1612-69.webp)
ET1612-69 100 µL
HDAC10 Recombinant Rabbit Monoclonal Antibody [SD08-11]
Sign In for Pricing
View Details 
