Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coro2b Peptide - N-terminal region

Coro2b Peptide - N-terminal region

Product Specifications

Product Name Alternative

CLIPINC, E130012P22Rik

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Coro2b Rabbit Polyclonal Antibody (orb581585) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

GGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL4P2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
41712151 3x 1.0 µg DNA

RPL4P2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Carbutamide-D9
TRC-C183302-10MG 10 mg

Carbutamide-D9

Sign In for Pricing
View Details
Human SULF1 (Sulfatase 1) ELISA Kit
EH25422 96 Tests

Human SULF1 (Sulfatase 1) ELISA Kit

Sign In for Pricing
View Details
Anti-Syntaxin 4 Rabbit Monoclonal Antibody
M05345 100 µL/Vial

Anti-Syntaxin 4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
STK16 (NM_001008910) Human Recombinant Protein
TP319087M 100 µg

STK16 (NM_001008910) Human Recombinant Protein

Sign In for Pricing
View Details
N-DMTr-N2-isobutyryl-morpholino-G-5'-O-phosphoramidite
TNU1600-01 10 mg

N-DMTr-N2-isobutyryl-morpholino-G-5'-O-phosphoramidite

Sign In for Pricing
View Details