Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coro2b Peptide - N-terminal region

Coro2b Peptide - N-terminal region

Product Specifications

Product Name Alternative

CLIPINC, E130012P22Rik

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Coro2b Rabbit Polyclonal Antibody (orb581585) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

GGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant UPF0154 protein spyM18_0409 (spyM18_0409)
MBS1260926 Inquire

Recombinant UPF0154 protein spyM18_0409 (spyM18_0409)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster UPF0532 protein CG3570 (CG3570)
MBS1453473-01 0.02 mg (E-Coli)

Recombinant Drosophila melanogaster UPF0532 protein CG3570 (CG3570)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster UPF0532 protein CG3570 (CG3570)
MBS1453473-02 0.02 mg (Yeast)

Recombinant Drosophila melanogaster UPF0532 protein CG3570 (CG3570)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster UPF0532 protein CG3570 (CG3570)
MBS1453473-03 0.1 mg (E-Coli)

Recombinant Drosophila melanogaster UPF0532 protein CG3570 (CG3570)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster UPF0532 protein CG3570 (CG3570)
MBS1453473-04 0.1 mg (Yeast)

Recombinant Drosophila melanogaster UPF0532 protein CG3570 (CG3570)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster UPF0532 protein CG3570 (CG3570)
MBS1453473-05 0.02 mg (Baculovirus)

Recombinant Drosophila melanogaster UPF0532 protein CG3570 (CG3570)

Sign In for Pricing
View Details